No.8 Jinshun Road Zhuqiao Pudong New District, Shanghai, Cina
Rumah ProdukPeptida Suntik

Muscle Building Peptides CJC-1295 Tanpa DAC untuk Binaragawan

Muscle Building Peptides CJC-1295 Tanpa DAC untuk Binaragawan

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    Detail produk:

    Tempat asal: Shanghai
    Nama merek: FILTER
    Sertifikasi: GMP
    Nomor model: API

    Syarat-syarat pembayaran & pengiriman:

    Kuantitas min Order: 10 vial
    Harga: USD 4~8 per vial
    Kemasan rincian: 2mg, 5mg / vial, 10mg / vial atau sesuai kebutuhan
    Waktu pengiriman: dalam 3 hari kerja
    Syarat-syarat pembayaran: L / C, T / T, Western Union, MoneyGram, Payneer
    Menyediakan kemampuan: 100.000 vials / bulan
    Kontak
    Detil Deskripsi produk
    Spesifikasi: 2mg / vial Penampilan: bubuk putih
    Waktu pengiriman: dalam waktu 3 ~ 7 hari kerja Pelabuhan: Shanghai / Shenzhen / Hongkong
    Paket: Icebag, cara Packing yang bijaksana untuk referensi Anda LimitNum: 10 vial
    Kemurnian: 99% Transportasi: DHL, Fedix, HKEMS, HKEUB, TNT
    Penyimpanan: tempat kering, gelap dan berventilasi, (2 ~ 8 dogree)
    Cahaya Tinggi:

    peptides bodybuilding supplements

    ,

    human growth peptides

    CJC-1295 dengan DAC

    Nama Produk: CJC1295 DAC; CJC1295 dengan DAC
    Alias: CJC1295 (GHRH / DAC)
    Urutan: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu- Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) -NH2 (Kompleks Afinitas)
    Kepadatan: 1,45
    CJC-1295 dengan DAC
    Tipe: Agen Fungsi KekebalanGrade
    Standar: Kelas Kedokteran
    Klasifikasi: Brassinosteroid
    MF: C165H271N47O46
    Berat Molekul: 3649.30
    Kemurnian (HPLC): 98,0%
    Penampilan: Serbuk putih
    Pengotor Tunggal (HPLC): 1,0%
    Komposisi Asam Amino: 10% dari teori
    Konten Peptida (N%): 80% (oleh% N)
    Kadar Air (Karl Fischer): 6.0%
    Konten Asetat (HPIC): 15,0%
    Neraca Massal: 95.0 ~ 105.0%

    Filter Bio-Tech Co, Ltd Bidang bisnis:

    Sebagai produsen Peptides dan Steroid, kami untuk OEM untuk klien yang memiliki Persyaratan Merek. (Layanan Custom-made).
    Layanan Perusahaan kami:

    1. Peptida Farmasi + Peptida Tubuh
    2. Peptida kosmetik
    3. Sterodis Powder, Minyak dan Tab
    4. Layanan Custom-made

    Jenis mana yang disukai klien Anda?

    Deskripsi
    Nama Produk: CJC1295
    Sinonim: CJC1295; Y (d -A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutamin-L-glutamin-L- L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L- leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3- (2,5-dihydro-2,5-dioxo-1H-pyrrol- 1-yl) -1-oxopropyl] -L-lysinamide; CJC-1295 Asetat; CJC1295 tanpa DAC
    CAS: 863288-34-0
    MF: C159H258N46O45
    MW: 0
    EINECS:
    Kategori Produk: Peptida


    Proses kami:
    Proses kontrol kualitas
    1) Pembelian
    Teliti riset pasar, pahami harga bahan baku dan kinerja. Agar sumber pengadaan mengerti sepenuhnya, dan sepenuhnya menjamin kualitas pengadaan bahan baku.


    2) Inspeksi
    Empat langkah: pengambilan sampel, pretreatment sampel, pengukuran dan pemrosesan data.


    3) Memproduksi
    a) Setiap operator harus melakukan inspeksi sendiri terhadap produk dan membuat catatan inspeksi yang sesuai.
    b) Inspektur penuh waktu melalui pemeriksaan swa-inspeksi operator, dan tinjau dan masukkan catatan yang sesuai. Inspeksi penuh waktu bertanggung jawab untuk inspeksi produk jadi, dan membuat catatan inspeksi produk jadi masuk.


    4) Sebelum menjual
    Hasil tes dapat diberikan sebelum menjual.
    Lembaga deteksi pihak ketiga diizinkan jika Anda tidak puas dengan hasil tes.


    Keuntungan kita:
    1. Kualitas:
    Perusahaan kami adalah produksi hormon antara profesional selama bertahun-tahun, produk kami telah diekspor ke Jerman, Spanyol, Inggris, Amerika Serikat, Australia, Timur Tengah, dan di negara lain, dan kami telah mendapat umpan balik yang sangat baik dari pelanggan kami, Anda dapat Percayalah pada kami.
    Dan kami adalah pabrik, jadi tidak ada masalah bagi kami untuk mengontrol kualitas.
    2. Metode pembayaran: Western Union, TT.
    3. Layanan: Layanan terbaik dengan layanan purna jual untuk semua klien.
    4. Pengiriman:
    Pesanan Sampel: Paket akan dikirim dengan 3 hari setelah pembayaran. Kami dapat mengirimkannya melalui UP, EMS, HK Air Post, DHL atau metode lainnya. Kami memiliki logistik yang profesional dan stabil, dan kami dapat mengirimkan paket dengan lancar sekitar 3 hingga 5 hari.


    Peptida lain Pasokan Laboratorium Kami:

    Produk Kemurnian Nomer CAS.
    Glukagon Hidroklorida 98% 16941-32-5
    Asetat Gonadorelin 98% 34973-08-5
    Goserelin Acetate 98% 145781-92-6
    GRF (manusia) Asetat 98% 83930-13-6
    Hexarelin Acetate 98% 140703-51-1
    Asetat Histrelin 98% 76712-82-8
    Asetat yang Kompatibel 98% 30308-48-4
    Lanreotide 98% 108736-35-2
    Lecirelin (Dalmarelin) Asetat 98% 61012-19-9
    Leuprolide 98% 74381-53-6
    Leuprorelin Acetate 98% 53714-56-0
    Linaclotide Acatate 98% 851199-59-2
    Lixisenatide 98% 320367-13-3
    Lraglutide 98% 204656-20-2
    Asetsi Lysipressin 98% 50-57-7
    Melanotan II Acetate 98% 121062-08-6
    MOG (35-55) 98% 163913-87-9
    Nafarelin Acetate 98% 76932-56-4
    Nesiritide Acetate (BNP-32) 98% 114471-18-0
    Octreotide 98% 79517-01-4
    Ornipressin Asetat 98% 3397-23-7
    Oksitosin Asetat 98% 50-56-6
    Palmitoyl Pentapeptide 98% 214047-00-4
    Pexiganan 98% 147664-63-9
    Pramlintide Acetate 98% 196078-30-5
    Pretirelin
    PT141 Asetat 98% 32780-32-8
    Salmon Kalsitonin Asetat 98% 47931-85-1
    Secretin Acetate 98% 10813-74-8
    Sermorelin Acetate 98% 86168-78-7
    Sincalide 98% 25126-32-3
    Somatostatin Asetat 98% 38916-34-6
    Splenopentin Asetat 98% 105184-37-0
    Taltirelin Acetate 98% 103300-74-9
    Asetat Teriparatide 98% 52232-67-4
    Asetat Teriparatide 98% 52232-67-4
    Asetat Terlipressin 98% 14636-12-5
    Tetracosactide Acetate 98% 16960-16-0
    Thymalfasin 98% 62304-98-7
    Thymopentin 98% 69558-55-0
    Timin α1 Asetat 98% 14636-12-5
    Timin β4 Asetat (TB-500) 98% 77591-33-4
    Triptorelin Acetate 98% 57773-63-4
    Asetat Vapreotide 98% 103222-11-3
    Vasopresin Asetat 98% 9034-50-8
    Zikonotida Asetat 98% 107452-89-1

    Laboratorium

    Kebijakan Klien VIP:
    Jika Jumlah Total Pembelian Anda di perusahaan kami per tahun dapat mencapai 50.000 USD, pada akhir tahun, kami dapat menggunakan 2% -5% dari Jumlah Total untuk mengirim barang Gratis.

    Jenis Pelanggan yang memiliki lebih banyak dukungan:
    1. Pelanggan potensial
    (Dengan Data Pembelian + Nomor Klien Pasar Saat Ini dan Jumlah Produk per bulan untuk diterapkan)

    2. Kelompok pelanggan yang stabil dan pesanan kuantitas stabil per bulan
    (Dengan Data Pembelian lengkap dengan Perusahaan kami untuk Mendaftar)

    3. Pengguna Pribadi Reguler
    (Dengan Data Pembelian lengkap dengan Perusahaan kami untuk Mendaftar)

    4. Klien yang memiliki dana dan memiliki rencana untuk memperluas pasar
    (Dengan Data Pembelian + Nomor Klien Pasar Saat Ini dan Jumlah Produk per bulan untuk diterapkan)
    ** Data Nyata Saat Ini + Pasar Masa Depan (Berdasarkan Saat Ini)

    Rincian kontak
    Passion Technology Development Limited

    Kontak Person: Qin

    Mengirimkan permintaan Anda secara langsung kepada kami (0 / 3000)

    Produk lainnya
    Quote request suatu

    E-Mail | Peta Situs

    Privacy Policy Cina Bagus kualitas Peptida Suntik pemasok. © 2018 - 2020 peptide-steroids.com. All Rights Reserved.